[Credit

---

allumardiscreetdispatcepikgsimplifydsensualbeautygirldraaaaaculaaaa

---

LIVE

2damnfeisty:rozhanitsa:2damnfeisty:Nobody gives the black girl mob credit for being smart as fuck. T

andtosaturn:HARRY STYLES HEADERS→ 8 headers→ transparent cut for any bg colour→ no need to credit bu

albedo from genshin impact> 300x300 icons> suggested by anonymous> like/reblog + credit if

venti 300x300 icons> like/reblog if using + please credit!

lemonlulz:junk-watch:”Embrace tranquillity.”Credit: Animation by Ardy@yabbyabb

transtimmers: Minimus Ambus Stimboard for @goopy-sins!  Credit/Sources under cut! Keep reading

transtimmers:✨G1 Optimus Prime Stimboard with a Hanukkah theme!✨ Credit/Sources under the cut! Keep

transtimmers: MTMTE Tarn Stimboard  Credit/Sources under cut! Keep reading

transtimmers:MTMTE Overlord Stimboard for @homosexual-disaster-ziggy! Credit/Sources under cut! Keep

transtimmers: Halloween Swindle Stimboard! Happy Halloween from me! owo)/Credit/Sources under cut: K

his-little-girl-x:xoxo-beth:Learning by his belt.(With @boysansname. Please don’t remove the credit

yvesmathieu:Photo Credit : Alison BushorIg: the_yvesdropper

xfreischutz:motif swap! feel free to use the transparent versions for personal use, with credit some

tsumomos:some hinata iconslike, reblog, and credit if you use/save themfeel free to request another

h0lllister:chicken nuggets are heavenlyinstagram | marisaallan - don't repost without credit

applejam:credit: honeybeesolskinn !!

astronyma:allura with glowing marks!please like/reblog if using, credit isn’t needed but would be ap

malewifebumju:lesbian toph imbalance icons!like/rb if you use | credit appreciated but not necessary

vintagexgraphics:Celebrity Phone Lockscreens | Credit @vxgraphics on twitter!works on ALL iPhones &a

credit

Credit to u/WrathfulSausage for the image

3eautiful:credit

more here credit

3eautiful:credit

Prev PageNext Page