Ayase Minami

---

large skipperefecanimleggyangelslittledazzererictrotter3504

---

LIVE

it be like this

April Fools 2019 Children μ’s - [1/1]

Tea Party version - [¼]

Tea Party version - [2/4]

aesthetic for a kotori who is in love with eli for anon!! let me know if you’d like anything changed

μ’s | christmas icons ☆彡

μ’s| christmas icons ☆彡

Love Live! 1366 x 768 BackgroundsCool Girls - Eli, Maki, Umi & Riko, Yoshiko, Dia - Swimsuit &am

Miki Sunohara, Mikuni Maisaki, Minami Ayase, Shiori Satozaki

I really like their unidolized ver. *O* Full View on DeviantART // Redbubble Store

LoveLive! HAPPY 8TH ANV!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

μ’sic forever ♪♪♪♪♪♪♪♪♪

Ok so!As an apology for being so nonexistent this past week and a half,I made Tarot cards for all of

– Trying to remember how to draw boys hehe. Should I draw Aqours too?

And now some μ’s subunit mobile wallpapers!The BiBi one was kind of an experiment but I hope you all

✧･ﾟ: *✧ Happy Pocky Day! (Posted during 11/11) ✧ *:･ﾟ✧♡ Characters ♡ :- Rin Hoshizora ♥ Hanayo Koizu

♥  ~ Animal Version Part 2 ~ ♥ [2/4] ♥

♥  ~ Kira Kira Sensation ~ ♥ [2/2] ♥

♥  ~ Animal Version Part 2 ~ ♥ [¼] ♥ 

♥  ~ Kira Kira Sensation ~ ♥ [½] ♥ 

These gorgeous wall scrolls from Love Live launch in September pre-order them while you can!Direct L

♥  ~ HEART to HEART ~ ♥ [1/1] ♥

♥  ~ Snow Halation V2 ~ ♥ [1/1] ♥

Love Live! School Idol Festival ALL STARS - q’s icons.  ✫ Use it as you want, but please, give sour

Prev PageNext Page